PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn385361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 1777aa    MW: 199400 Da    PI: 4.9822
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn385361genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.69.2e-182882357
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                kR   t++qle+Le+ ++ + yps++ r+eL+ +lgL++rq ++WF+ rR k++k
  Achn385361 28 KRKMKTASQLEILEKTYAVETYPSEALRAELSVQLGLSDRQLQMWFCHRRLKDRK 82
                89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-171182IPR009057Homeodomain-like
SuperFamilySSF466892.31E-152182IPR009057Homeodomain-like
PROSITE profilePS5007116.4222383IPR001356Homeobox domain
SMARTSM003896.4E-162587IPR001356Homeobox domain
CDDcd000864.89E-132683No hitNo description
PfamPF000462.0E-152882IPR001356Homeobox domain
PROSITE profilePS5082717.031563622IPR018501DDT domain
SMARTSM005711.5E-22563622IPR018501DDT domain
PfamPF027911.1E-16565619IPR018501DDT domain
PfamPF050663.2E-14745813IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.6E-99681012IPR028942WHIM1 domain
PfamPF156133.3E-1111531225IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1777 aa     Download sequence    Send to blast
MEEGGSGGGG GGSDVEKKKK PEGESKVKRK MKTASQLEIL EKTYAVETYP SEALRAELSV  60
QLGLSDRQLQ MWFCHRRLKD RKTPPVKRQK KDFTVAPASS SGVGDEMVVG EVGNEHASGS  120
GSGSSPFGHV ESQHQRVAPR TGAAIARIAT DMPTVKRYYE PPQAISELRA IAFVEAQLGE  180
PLREDGPILG MEFDPLPPGA FGAPIMSVGQ QKPATRHYES NLYERTDAKP IKNAVRALHE  240
YQFLPEQPSV RNDSFERAAP SHYYGSPTDV PSARSALSTG RSYMHGNEQV PPAFGFQGQT  300
PSLGLLPHQG RQSHLLPSTS AEYDIVSRKT SIANIGTDAH FGTHPITALD NPFIPSERQV  360
TNDEDIARLE RKRKVCTQSE EARIAREVEA HEKRIRKELE KQDILRRKRE EQMRKEMERQ  420
DRERRKEEER LLREKQREEV RYQREQRREM ERREKFLQKE SIRAEKLRLK EELRREKDAA  480
RQKAASDRAT ARRIAKESME LIEDERLELM ELAASSKGLP SILSLDGETL QNLELFKDKL  540
IVFPPKSVNL KRPFAIKPWC DSEENTGNLF MVWRFLITFA DVLGLWPFTL DEFVQAFHDY  600
DPRLLGEIHI ALLRSIIKDI EDVARTPSTG LGTNQNYSAN PGGGHPQIVQ GAYAWGFDIR  660
SWQRHLNPLT WPEILRQFAL AAGYGPKLKK RSIEQAYIRD ENEGDGGEDV ISILRNGAAA  720
ENAVAIMQER GFSNPRRSRH RVTPGTVKFA AFHVLSLEGS DGLTILEVAD RIQKSGLRDL  780
TTSRTPEASI AAALSRDTKL FERTAPSTYC VRSPYRKDPA DAEAILSAAR EKIQIFKNGY  840
LDGEDAEDVE HDDVERDEDS ESDVAEDPEA DDLGTEMKPN NEALSCEANR FLTKTYPGDG  900
KEASHDEVMR TTQVGLKNLA GSSPLMQSEG YKGVKRTSAS VDQSVDVARI SNEAANLDQE  960
DTVIDESNSG EPWVQGLVEG EYSDLSVEER LNALVALIGV ANEGNSIRVV LEDRLEAANA  1020
LKKQMWAEVQ LDKRRMKEDY VMKMQYSSFI SCKSEPNIQF SSVEGRQSPL PAVDDKNVLA  1080
STNPVIQQEH IQDSQNDTNY CTPIPTERNQ SIQEFSAGTD NHPLLQTGFA AERSRSQLKA  1140
YIGHKAEEMY VYRSLPLGQD RRRNRYWQFI TSASRNDPGS GRIFVELRDG CWRLIDSEED  1200
FDALLESLDV RGSKESNLHS MLQKVEVYFK ETLRKNLVHT KTEWLTVDNI KNEVAEMASK  1260
PDCSGSTDSP TSTCCVSNSD LPEPSSSFAI DLGRNEAEKR DALKRYQDLE KWMWEECLNS  1320
SVLCAIKFGK KRCKQLLDIC DYCLDLYLSE DNYCPSCHRT SETSILDGNF SEHVAQWRKK  1380
FEAEAIQPDW SEAYRKSWGM KLHASSSAED LLQILTLLEG AINKDFLSSN FETTKELLGS  1440
CNRTESAANI SVNPEIIAVL PWVPQTSSAV TLRLMELDAS ISYMLHQKID SYKDKGAGDF  1500
FALPSKFALV KSIPEDDLIE TPHEGENLLQ EPWIDHGSVH SSSGRGRGAR GRGRGRTRGG  1560
RSQRQSISSR SVAAPRSTTT NNERFGQLLG WKGRSRGRGG RKRSRRTARS RQKPGKRVAD  1620
IGSERDQQKE IFFDNTVRSL GPQWNREETM EIQVEAAENA SSSERSEYDD YNGLAAGDEY  1680
DDLLPNDYSS VFNGKSDHLI PGVDYNVDGE EDDDDRVEGD DDVDDEEDDS NQDEHGDTDV  1740
ERYINDDSDD EGNQDGGEPI GNPDEATGST SSDFSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115461554RGARGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4574737e-45AM457473.2 Vitis vinifera contig VV78X112028.14, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275272.10.0PREDICTED: uncharacterized protein LOC100250601 isoform X2
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A067JX120.0A0A067JX12_JATCU; Uncharacterized protein
STRINGPOPTR_0017s04760.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21422352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator